Structure of PDB 4wx6 Chain C Binding Site BS01

Receptor Information
>4wx6 Chain C (length=204) Species: 31545 (Human adenovirus D8) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SGSSEQELAAIVRDLGCGPYFLGTHDKRFPGFLAGNKLACAIVNTAGRET
GGVHWLAFGWNPRSRTCYMFDPFGFSDRRLKQIYSFEYEAMLRRSALALS
PDRCLSLEQSTQTVQGPDSAACGLFCCMFLHAFVHWPDRPMDGNPTMNLL
TGVPNGMLQSPQVLPTLRRNQEKLYRFLAHHSPYFRSHRAAIEHATAFDK
MKQL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4wx6 Structure-based design and optimization of potent inhibitors of the adenoviral protease.
Resolution2.15 Å
Binding residue
(original residue number in PDB)		E89 R93 R103 C104 L105 S106 L107 E108 Q109 S110 T111 Q112 M141 D142 M147 L150 G152
Binding residue
(residue number reindexed from 1)		E89 R93 R103 C104 L105 S106 L107 E108 Q109 S110 T111 Q112 M141 D142 M147 L150 G152
Enzymatic activity
Catalytic site (original residue number in PDB) H54 D71 Q115 C122
Catalytic site (residue number reindexed from 1) H54 D71 Q115 C122
Enzyme Commision number 3.4.22.39: adenain.
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004197 cysteine-type endopeptidase activity
GO:0008234 cysteine-type peptidase activity
Biological Process
GO:0006508 proteolysis
Cellular Component
GO:0042025 host cell nucleus
GO:0044423 virion component

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4wx6, PDBe:4wx6, PDBj:4wx6
PDBsum4wx6
PubMed25571794
UniProtB9A5C1

[Back to BioLiP]