Structure of PDB 4wwu Chain C Binding Site BS01

Receptor Information

>4wwu Chain C (length=165) Species: 559292 (Saccharomyces cerevisiae S288C)

MVMNDANQAQITATFTKKILAHLDDPDSNKLAQFVQLFNPNNCRIIFNAT
PFAQATVFLQMWQNQVVQTQHALTGVDYHAIPGSGTLICNVNCKVRFDES
GRDKMGQDATVPIQMNKPRPLWGPYFGISLQLIIDDRIFRNDFNGVISGF
NYNMVYKPEDSLLKI

Ligand information

• Ligand ID: ZN
• InChI: InChI=1S/Zn/q+2
• InChIKey: PTFCDOFLOPIGGS-UHFFFAOYSA-N
• SMILES:
  CACTVS 3.341: [Zn++]
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Zn+2]
• Formula: Zn
• Name: ZINC ION
• ChEMBL: CHEMBL1236970
• DrugBank: DB14532
• PDB chain: 4wwu Chain C Residue 201

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4wwu Domain organization within the nuclear export factor Mex67:Mtr2 generates an extended mRNA binding surface.
• Resolution: 3.301 Å
• Binding residue (original residue number in PDB): K25 H29
• Binding residue (residue number reindexed from 1): K18 H22
• Annotation score: 4

Gene Ontology

Molecular Function

• GO:0005515 protein binding

Biological Process

• GO:0000055 ribosomal large subunit export from nucleus
• GO:0000056 ribosomal small subunit export from nucleus
• GO:0006406 mRNA export from nucleus
• GO:0006409 tRNA export from nucleus
• GO:0006913 nucleocytoplasmic transport
• GO:0008033 tRNA processing
• GO:0016973 poly(A)+ mRNA export from nucleus

Cellular Component

• GO:0005634 nucleus
• GO:0042272 nuclear RNA export factor complex
• GO:0044613 nuclear pore central transport channel

External links

• PDB: RCSB:4wwu, PDBe:4wwu, PDBj:4wwu
• PDBsum: 4wwu
• PubMed: 25618852
• UniProt: P34232|MTR2_YEAST mRNA transport regulator MTR2 (Gene Name=MTR2)