Structure of PDB 4wuz Chain C Binding Site BS01

Receptor Information
>4wuz Chain C (length=225) Species: 10710 (Lambdavirus lambda) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TPDIILQRTGIDVRAVEQGDDAWHKLRLGVITASEVHNVIAKPRSGKKWP
DMKMSYFHTLLAEVCTGVAPEVNAKALAWGKQYENDARTLFEFTSGVNVT
ESPIIYRDESMRTACSPDGLCSDGNGLELKCPFTSRDFMKFRLGGFEAIK
SAYMAQVQYSMWVTRKNAWYFANYDPRMKREGLHYVVIERDEKYMASFDE
IVPEFIEKMDEALAEIGFVFGEQWR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4wuz Crystal Structure of lambda Exonuclease in Complex with DNA and Ca(2+).
Resolution2.38 Å
Binding residue
(original residue number in PDB)		K43 R45 P51 D52 M53
Binding residue
(residue number reindexed from 1)		K42 R44 P50 D51 M52
Enzymatic activity
Catalytic site (original residue number in PDB) E93 E102 D109 E129 L130 K131
Catalytic site (residue number reindexed from 1) E92 E101 D108 E128 L129 K130
Enzyme Commision number 3.1.11.3: exodeoxyribonuclease (lambda-induced).
Gene Ontology
Molecular Function
GO:0004527 exonuclease activity
GO:0046872 metal ion binding
GO:0051908 double-stranded DNA 5'-3' DNA exonuclease activity
Biological Process
GO:0006259 DNA metabolic process

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4wuz, PDBe:4wuz, PDBj:4wuz
PDBsum4wuz
PubMed25370446
UniProtP03697|EXO_LAMBD Exonuclease (Gene Name=exo)

[Back to BioLiP]