Structure of PDB 4wci Chain C Binding Site BS01

Receptor Information
>4wci Chain C (length=63) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPLGSMVDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGR
RGMFPDNFVKEIK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4wci Differential Recognition Preferences of the Three Src Homology 3 (SH3) Domains from the Adaptor CD2-associated Protein (CD2AP) and Direct Association with Ras and Rab Interactor 3 (RIN3).
Resolution1.65 Å
Binding residue
(original residue number in PDB)		Y8 D16 E17 E34 W37 P50 N52 F53
Binding residue
(residue number reindexed from 1)		Y13 D21 E22 E39 W42 P55 N57 F58
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4wci, PDBe:4wci, PDBj:4wci
PDBsum4wci
PubMed26296892
UniProtQ9Y5K6|CD2AP_HUMAN CD2-associated protein (Gene Name=CD2AP)

[Back to BioLiP]