Structure of PDB 4uyj Chain C Binding Site BS01

Receptor Information
>4uyj Chain C (length=74) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PQYQTWEEFSRAAEKLYLADPMKARVVLKYRHSDGNLCVKVTDDLVCLVY
KTDQAQDVKKIEKFHSQLMRLMVA
Ligand information
>4uyj Chain S (length=110) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggggcuaggccgggggguucggcguccccuguaaccggaaaccgccgaua
ugccggggccgaagcccgaggggcgguucccguaaggguucccacccucg
ggcgugccuc
<<<<<..<<<<<<<<<<..(((((>>>>>>....<<<<....)))))...
..>>>>>>>>...<<<<<<<<<..<<..<<<....>>>..>>..>>>>>>
>>>..>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4uyj Crystal Structure of a Signal Recognition Particle Alu Domain in the Elongation Arrest Conformation.
Resolution3.35 Å
Binding residue
(original residue number in PDB)		P2 R26 K30 R32 D45 L46 C48
Binding residue
(residue number reindexed from 1)		P1 R25 K29 R31 D44 L45 C47
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005047 signal recognition particle binding
GO:0005515 protein binding
GO:0008312 7S RNA binding
Biological Process
GO:0006614 SRP-dependent cotranslational protein targeting to membrane
GO:0045900 negative regulation of translational elongation
Cellular Component
GO:0005737 cytoplasm
GO:0005785 signal recognition particle receptor complex
GO:0005786 signal recognition particle, endoplasmic reticulum targeting
GO:0005829 cytosol
GO:0048500 signal recognition particle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4uyj, PDBe:4uyj, PDBj:4uyj
PDBsum4uyj
PubMed25336584
UniProtP49458|SRP09_HUMAN Signal recognition particle 9 kDa protein (Gene Name=SRP9)

[Back to BioLiP]