Structure of PDB 4u9w Chain C Binding Site BS01

Receptor Information
>4u9w Chain C (length=195) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RAAMDAVCAKVDAANRLGDPLEAFPVFKKYDRNGLNVSIECKRVSGLEPA
TVDWAFDLTKTNMQTMYEQSEWGWKDREKREEMTDDRAWYLIAWENSSVP
VAFSHFRFDVECGDEVLYCYEVQLESKVRRKGLGKFLIQILQLMANSTQM
KKVMLTVFKHNHGAYQFFREALQFEIDDSSPSDCSYEILSRRTKF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4u9w The Molecular Basis for Histone H4- and H2A-Specific Amino-Terminal Acetylation by NatD.
Resolution2.49 Å
Binding residue
(original residue number in PDB)
Y85 W90 D127 E129 Y136 Y138 E139 T174 Y211
Binding residue
(residue number reindexed from 1)
Y67 W72 D109 E111 Y118 Y120 E121 T156 Y186
Enzymatic activity
Enzyme Commision number 2.3.1.257: N-terminal L-serine N(alpha)-acetyltransferase NatD.
Gene Ontology
Molecular Function
GO:0010485 histone H4 acetyltransferase activity
GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups
GO:0043998 histone H2A acetyltransferase activity

View graph for
Molecular Function
External links
PDB RCSB:4u9w, PDBe:4u9w, PDBj:4u9w
PDBsum4u9w
PubMed25619998
UniProtQ86UY6|NAA40_HUMAN N-alpha-acetyltransferase 40 (Gene Name=NAA40)

[Back to BioLiP]