Structure of PDB 4tzq Chain C Binding Site BS01

Receptor Information
>4tzq Chain C (length=237) Species: 6239 (Caenorhabditis elegans) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ADSIDDKKWSKLFPRIVSDPDRSSNFMTRAIYVAFSAVLRNRNILGQEYF
TKNYITEKLKCMTLCFRNLRSNQIAQLLRNAGDATKDGFLKEVSLVITNN
EGDLEAIEVFSMKFIYFENGGVVARLSTDKNGQEDPHFAKLAQLVYEGGD
SVRDQMVTIVRSVQFLCTKVLEPLPEEFTANFRLEYTNDAPSNFRIDGFE
DSSTFYTLPDDIQSATIGHLRPGCHAANMECWSMLMS
Ligand information
>4tzq Chain D (length=13) Species: 6239 (Caenorhabditis elegans) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ARYGVSNTSINRK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4tzq The Chromosome Axis Controls Meiotic Events through a Hierarchical Assembly of HORMA Domain Proteins.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		I59 L92 E191 F193 T194 A195 N196 F197 R198 L199 E200 Y201 S207 F209 G213 F214 E215 D216 S217 S218 T219 F220
Binding residue
(residue number reindexed from 1)		I44 L77 E176 F178 T179 A180 N181 F182 R183 L184 E185 Y186 S192 F194 G198 F199 E200 D201 S202 S203 T204 F205
Enzymatic activity
Enzyme Commision number ?
External links