Structure of PDB 4tvq Chain C Binding Site BS01

Receptor Information
>4tvq Chain C (length=205) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MRMTMEEMKNEAETTSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIK
AEKENPGLTQDIIMKILEKKSVEVNFTESLLRMAADEYMIERPEPEFQDL
NEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQ
NRRALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLIL
QTFKT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4tvq CCM2-CCM3 interaction stabilizes their protein expression and permits endothelial network formation.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		I131 A135 K139 L142 N146 S171 S175 K179 F182
Binding residue
(residue number reindexed from 1)		I128 A132 K136 L139 N143 S166 S170 K174 F177
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0019901 protein kinase binding
GO:0042803 protein homodimerization activity
Biological Process
GO:0001525 angiogenesis
GO:0003158 endothelium development
GO:0006915 apoptotic process
GO:0008284 positive regulation of cell population proliferation
GO:0010628 positive regulation of gene expression
GO:0010629 negative regulation of gene expression
GO:0030335 positive regulation of cell migration
GO:0032874 positive regulation of stress-activated MAPK cascade
GO:0033138 positive regulation of peptidyl-serine phosphorylation
GO:0035023 regulation of Rho protein signal transduction
GO:0035556 intracellular signal transduction
GO:0036481 intrinsic apoptotic signaling pathway in response to hydrogen peroxide
GO:0043066 negative regulation of apoptotic process
GO:0043149 stress fiber assembly
GO:0043406 positive regulation of MAP kinase activity
GO:0044319 wound healing, spreading of cells
GO:0045747 positive regulation of Notch signaling pathway
GO:0045765 regulation of angiogenesis
GO:0050821 protein stabilization
GO:0051683 establishment of Golgi localization
GO:0071902 positive regulation of protein serine/threonine kinase activity
GO:0090051 negative regulation of cell migration involved in sprouting angiogenesis
GO:0090168 Golgi reassembly
GO:0090316 positive regulation of intracellular protein transport
GO:1903358 regulation of Golgi organization
GO:1903588 negative regulation of blood vessel endothelial cell proliferation involved in sprouting angiogenesis
GO:1990830 cellular response to leukemia inhibitory factor
Cellular Component
GO:0000139 Golgi membrane
GO:0005737 cytoplasm
GO:0005794 Golgi apparatus
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0070062 extracellular exosome
GO:0090443 FAR/SIN/STRIPAK complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4tvq, PDBe:4tvq, PDBj:4tvq
PDBsum4tvq
PubMed25825518
UniProtQ9BUL8|PDC10_HUMAN Programmed cell death protein 10 (Gene Name=PDCD10)

[Back to BioLiP]