Structure of PDB 4tot Chain C Binding Site BS01

Receptor Information
>4tot Chain C (length=164) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QNPLVYLDVGADGQPLGRVVLELKADVVPKTAENFRALCTGEKGFGYKGS
TFHRVIPAFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLSMA
NAGPNTNGSQFFICTIKTDWLDGKHVVFGHVIEGMDVVKKIESFGSKSGK
TSKKIVITDCGQLS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4tot Potent nonimmunosuppressive cyclophilin inhibitors with improved pharmaceutical properties and decreased transporter inhibition.
Resolution2.39 Å
Binding residue
(original residue number in PDB)		R55 F60 M61 Q63 G72 T73 A101 N102 Q111 F113 W121 L122 H126
Binding residue
(residue number reindexed from 1)		R54 F59 M60 Q62 G71 T72 A100 N101 Q110 F112 W120 L121 H125
Enzymatic activity
Catalytic site (original residue number in PDB) R55 F60 Q63 N102 F113 L122 H126
Catalytic site (residue number reindexed from 1) R54 F59 Q62 N101 F112 L121 H125
Enzyme Commision number 5.2.1.8: peptidylprolyl isomerase.
Gene Ontology
Molecular Function
GO:0003755 peptidyl-prolyl cis-trans isomerase activity
Biological Process
GO:0000413 protein peptidyl-prolyl isomerization
GO:0006457 protein folding

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4tot, PDBe:4tot, PDBj:4tot
PDBsum4tot
PubMed25310383
UniProtP29117|PPIF_RAT Peptidyl-prolyl cis-trans isomerase F, mitochondrial (Gene Name=Ppif)

[Back to BioLiP]