Structure of PDB 4tkn Chain C Binding Site BS01

Receptor Information

>4tkn Chain C (length=257) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PTEEVSLEVLLSNGQKVLVNVLTSDQTEDVLEAVAAKLDLPDDLIGYFSL
FLVREKEDGAFSFVRKLQEFELPYVSVTSLRSQEYKIVLRKSYWDSAYDD
DVMENRVGLNLLYAQTVSDIERGWILVTKEQHRQLKSLQEKVSKKEFLRL
AQTLRHYGYLRFDACVADFPEKDCPVVVSAGNSELSLQLQLREGSFRVTR
MRCWRVTSSVPLVRLELAFEYLMSKDRLQWVTITSPQAIMMSICLQSMVD
ELMVKKS

Ligand information

>4tkn Chain F (length=9) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

TCIYNPLFG

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4tkn Structural Determinants for Binding of Sorting Nexin 17 (SNX17) to the Cytoplasmic Adaptor Protein Krev Interaction Trapped 1 (KRIT1).
Resolution	3.0 Å
Binding residue (original residue number in PDB)	T316 R317 M318 R319 C320 W321 V380 L383 M384
Binding residue (residue number reindexed from 1)	T199 R200 M201 R202 C203 W204 V249 L252 M253

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0035091	phosphatidylinositol binding

	Biological Process
GO:0006886	intracellular protein transport
GO:0007165	signal transduction

	Cellular Component
GO:0005856	cytoskeleton

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4tkn, PDBe:4tkn, PDBj:4tkn
PDBsum	4tkn
PubMed	25059659
UniProt	Q15036\|SNX17_HUMAN Sorting nexin-17 (Gene Name=SNX17)

[Back to BioLiP]