Structure of PDB 4s0n Chain C Binding Site BS01

Receptor Information
>4s0n Chain C (length=124) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPGSVDSVLFGSLRGHVVGLRYYTGVVNNNEMVALQRDPNNPYDKNAIKV
NNVNGNQVGHLKKELAGALAYIMDNKLAQIEGVVPFGANNAFTMPLHMTF
WGKEENRKAVSDQLKKHGFKLGPA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4s0n HLTF's Ancient HIRAN Domain Binds 3' DNA Ends to Drive Replication Fork Reversal.
Resolution1.501 Å
Binding residue
(original residue number in PDB)		G69 Y72 Y73 Y93 D94 H110 K113
Binding residue
(residue number reindexed from 1)		G19 Y22 Y23 Y43 D44 H60 K63
Binding affinityPDBbind-CN: Kd=13nM
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
3.6.4.-
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0008270 zinc ion binding
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides

View graph for
Molecular Function
External links
PDB RCSB:4s0n, PDBe:4s0n, PDBj:4s0n
PDBsum4s0n
PubMed26051180
UniProtQ14527|HLTF_HUMAN Helicase-like transcription factor (Gene Name=HLTF)

[Back to BioLiP]