Structure of PDB 4rtw Chain C Binding Site BS01

Receptor Information
>4rtw Chain C (length=57) Species: 9031 (Gallus gallus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MTFVALYDYVSRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGRTGYIP
SNYVAPS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4rtw Crystal structure of the c-Src-SH3 domain E93V/Q128R mutant in complex with the high affinity peptide APP12
Resolution1.24 Å
Binding residue
(original residue number in PDB)
Y90 R95 T96 E115 G116 D117 W118 N135 Y136
Binding residue
(residue number reindexed from 1)
Y7 R12 T13 E32 G33 D34 W35 N52 Y53
Enzymatic activity
Enzyme Commision number 2.7.10.2: non-specific protein-tyrosine kinase.
External links
PDB RCSB:4rtw, PDBe:4rtw, PDBj:4rtw
PDBsum4rtw
PubMed
UniProtP00523|SRC_CHICK Proto-oncogene tyrosine-protein kinase Src (Gene Name=SRC)

[Back to BioLiP]