Structure of PDB 4qyl Chain C Binding Site BS01

Receptor Information
>4qyl Chain C (length=117) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPLQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDF
FTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQG
GAVLRQARRQAEKMGID
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4qyl Structural insights into recognition of acetylated histone ligands by the BRPF1 bromodomain.
Resolution1.8 Å
Binding residue
(original residue number in PDB)
V32 D39 H43 Y82 N83 T87 I88 F89
Binding residue
(residue number reindexed from 1)
V32 D39 H43 Y82 N83 T87 I88 F89
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4qyl, PDBe:4qyl, PDBj:4qyl
PDBsum4qyl
PubMed25281266
UniProtP55201|BRPF1_HUMAN Peregrin (Gene Name=BRPF1)

[Back to BioLiP]