Structure of PDB 4qlc Chain C Binding Site BS01

Receptor Information
>4qlc Chain C (length=104) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLE
LAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAV
LLPK
Ligand information
>4qlc Chain I (length=166) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
actggccgccctggagaatcccggtgccgaggccgctcaattggtcgtag
acagctctagcaccgcttaaacgcacgtacgcgctgtcccccgcgtttta
accgccaaggggattactccctagtctccaggcacgtgtcagatatatac
atcctgtgcatgtaag
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4qlc Structural Mechanisms of Nucleosome Recognition by Linker Histones.
Resolution3.503 Å
Binding residue
(original residue number in PDB)
K14 R16 R28 R31 R76
Binding residue
(residue number reindexed from 1)
K1 R3 R15 R18 R63
Binding affinityPDBbind-CN: Kd=0.35uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0031492 nucleosomal DNA binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006325 chromatin organization
GO:0006334 nucleosome assembly
GO:0007526 larval somatic muscle development
GO:0031507 heterochromatin formation
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome
GO:0005700 polytene chromosome
GO:0005704 polytene chromosome band

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4qlc, PDBe:4qlc, PDBj:4qlc
PDBsum4qlc
PubMed26212454
UniProtP84051|H2A_DROME Histone H2A (Gene Name=His2A)

[Back to BioLiP]