Structure of PDB 4qj6 Chain C Binding Site BS01

Receptor Information
>4qj6 Chain C (length=99) Species: 11685 (HIV-1 M:B_ARV2/SF2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PQITLWKRPLVTIRIGGQLKEALLNTGADDTVLEEMNLPGKWKPKMIGGV
GGFIKVRQYDQIPIEICGHKVIGTVLVGPTPVNIIGRNLLTQIGCTLNF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4qj6 Structural basis and distal effects of Gag substrate coevolution in drug resistance to HIV-1 protease.
Resolution1.5 Å
Binding residue
(original residue number in PDB)
R8 G27 A28 D29 I47 G48 G49 P81 V82 I84
Binding residue
(residue number reindexed from 1)
R8 G27 A28 D29 I47 G48 G49 P81 V82 I84
Enzymatic activity
Catalytic site (original residue number in PDB) N25 T26 G27
Catalytic site (residue number reindexed from 1) N25 T26 G27
Enzyme Commision number 2.7.7.-
2.7.7.49: RNA-directed DNA polymerase.
2.7.7.7: DNA-directed DNA polymerase.
3.1.-.-
3.1.13.2: exoribonuclease H.
3.1.26.13: retroviral ribonuclease H.
3.4.23.16: HIV-1 retropepsin.
Gene Ontology
Molecular Function
GO:0004190 aspartic-type endopeptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:4qj6, PDBe:4qj6, PDBj:4qj6
PDBsum4qj6
PubMed25355911
UniProtP03369|POL_HV1A2 Gag-Pol polyprotein (Gene Name=gag-pol)

[Back to BioLiP]