Structure of PDB 4qbr Chain C Binding Site BS01

Receptor Information
>4qbr Chain C (length=136) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SRERLVYEVRQKCRNIEDICISCGSLNVTLEHPLFVGGMCQNCKNCFLEC
AYQYDDDGYQSYCTICCGGREVLMCDNNNCCRCFCVECVDLLVGPGAAQA
AIKEDPWNCYMCGHKGTYGLLRRREDWPSRLQMFFA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4qbr Engineering of a histone-recognition domain in a de novo DNA methyltransferase alters the epigenetic landscape of ESCs
Resolution1.902 Å
Binding residue
(original residue number in PDB)
D529 D531 Y533 Q534 G543 R544 E545 V546 L547 M548 D550 A575 I576 E578 W581
Binding residue
(residue number reindexed from 1)
D55 D57 Y59 Q60 G69 R70 E71 V72 L73 M74 D76 A101 I102 E104 W107
Enzymatic activity
Enzyme Commision number 2.1.1.-
2.1.1.37: DNA (cytosine-5-)-methyltransferase.
External links
PDB RCSB:4qbr, PDBe:4qbr, PDBj:4qbr
PDBsum4qbr
PubMed
UniProtQ9Y6K1|DNM3A_HUMAN DNA (cytosine-5)-methyltransferase 3A (Gene Name=DNMT3A)

[Back to BioLiP]