Structure of PDB 4qbq Chain C Binding Site BS01

Receptor Information
>4qbq Chain C (length=137) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPLGSLVYEVRQKCRNIEDICISCGSLNVTLEHPLFVGGMCQNCKNCFLE
CAYQYDDDGYQSYCTICCGGREVLMCGNNNCCRCFCVECVDLLVGPGAAQ
AAIKEDPWNCYMCGHKGTYGLLRRREDWPSRLQMFFA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4qbq Engineering of a histone-recognition domain in a de novo DNA methyltransferase alters the epigenetic landscape of ESCs
Resolution2.406 Å
Binding residue
(original residue number in PDB)
D529 D531 G543 R544 E545 V546 M548 A575 I576 W581
Binding residue
(residue number reindexed from 1)
D56 D58 G70 R71 E72 V73 M75 A102 I103 W108
Enzymatic activity
Enzyme Commision number 2.1.1.-
2.1.1.37: DNA (cytosine-5-)-methyltransferase.
External links
PDB RCSB:4qbq, PDBe:4qbq, PDBj:4qbq
PDBsum4qbq
PubMed
UniProtQ9Y6K1|DNM3A_HUMAN DNA (cytosine-5)-methyltransferase 3A (Gene Name=DNMT3A)

[Back to BioLiP]