Structure of PDB 4qae Chain C Binding Site BS01

Receptor Information
>4qae Chain C (length=163) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DLIPAPPLSKVPLQQNFQDNQFHGKWYVVGLAGNEVLREDKDPMKMWATI
YELEEDKSYNVTIVMPLAEKCEYLFQTFVPGSQPGEFTLGSGLVRVVSTN
YNQHAMVFFKVVWQNREVFWVTLYGRTKELTSELKENFIRFSKSLGLPEN
HIVFPVPIDQCID
Ligand information
>4qae Chain Q (length=24) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
THFPICIFCCGCCHRSKCGMCCKT
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4qae Structure of a hepcidin-binding anticalin in complex with its peptide ligand
Resolution2.1 Å
Binding residue
(original residue number in PDB)		I55 N65 T67 C76 Y78 Q174 C175
Binding residue
(residue number reindexed from 1)		I50 N60 T62 C71 Y73 Q160 C161
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005506 iron ion binding
GO:0005515 protein binding
GO:0036094 small molecule binding
GO:0042802 identical protein binding
GO:0140315 iron ion sequestering activity
GO:1903981 enterobactin binding
Biological Process
GO:0006826 iron ion transport
GO:0006915 apoptotic process
GO:0015891 siderophore transport
GO:0042742 defense response to bacterium
GO:0045087 innate immune response
GO:0120162 positive regulation of cold-induced thermogenesis
Cellular Component
GO:0005576 extracellular region
GO:0005615 extracellular space
GO:0031410 cytoplasmic vesicle
GO:0035580 specific granule lumen
GO:0060205 cytoplasmic vesicle lumen
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4qae, PDBe:4qae, PDBj:4qae
PDBsum4qae
PubMed
UniProtP80188|NGAL_HUMAN Neutrophil gelatinase-associated lipocalin (Gene Name=LCN2)

[Back to BioLiP]