Structure of PDB 4pxi Chain C Binding Site BS01

Receptor Information

>4pxi Chain C (length=200) Species: 1902 (Streptomyces coelicolor) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

LRAEQTRATIIGAAADLFDRRGYESTTLSEIVAHAGVTKGALYFHFAAKE
DLAHAILEIQSRTSRRLAKDLDGRGYSSLEALMRLTFGMARLCVQGPVLR
AGLRLATAGVVRPPLPHPFTEWREIATSRLLDAVRQSDVHQDIDVDSVAH
TLVCSVVGTRVVGREPRRLAEMWYILIRGMVPVTRRARYVTLAARLEQET

Ligand information

>4pxi Chain E (length=20) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

atacgggacgccccgtttat

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4pxi Structural and functional basis of transcriptional regulation by TetR family protein CprB from S. coelicolor A3(2)
Resolution	3.2 Å
Binding residue (original residue number in PDB)	L5 R6 A7 T10 T42 K43 G44 A45 F48 H49
Binding residue (residue number reindexed from 1)	L1 R2 A3 T6 T38 K39 G40 A41 F44 H45
Binding affinity	PDBbind-CN: Kd=200nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000976	transcription cis-regulatory region binding
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:4pxi, PDBe:4pxi, PDBj:4pxi
PDBsum	4pxi
PubMed	25092919
UniProt	O66122

[Back to BioLiP]