Structure of PDB 4pu3 Chain C Binding Site BS01

Receptor Information
>4pu3 Chain C (length=71) Species: 211586 (Shewanella oneidensis MR-1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IMASPLNQQSLGLLIKERRKSAALTQDVAAMLCGVTKKTLIRVEKGEDVY
ISTVFKILDGLGIDIVSAGWY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4pu3 The bacterial antitoxin HipB establishes a ternary complex with operator DNA and phosphorylated toxin HipA to regulate bacterial persistence.
Resolution3.39 Å
Binding residue
(original residue number in PDB)		V53 T54 T57 R60 D66 V67 Y68 T71
Binding residue
(residue number reindexed from 1)		V35 T36 T39 R42 D48 V49 Y50 T53
Binding affinityPDBbind-CN: Kd=5.5nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:4pu3, PDBe:4pu3, PDBj:4pu3
PDBsum4pu3
PubMed25056321
UniProtQ8EIX4|HIPB_SHEON Antitoxin HipB (Gene Name=hipB)

[Back to BioLiP]