Structure of PDB 4pcb Chain C Binding Site BS01

Receptor Information
>4pcb Chain C (length=280) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MLSHMVLTRQDIGRAASYYASEWQGKGAEELGLSGEVDSKRFRELLAGNI
GEGHRIMRSATRQDSKERIGLDLTFSAPKSVSLQALVAGDAEIIKAHDRA
VARTLEQAEARAQARQKIQGKTRIETTGNLVIGKFRHETSRERDPQLHTH
AVILNMTKRSDGQWRALKNDEIVKATRYLGAVYNAELAHELQKLGYQLRY
GKDGNFDLAHIDRQQIEGFSKRTEQIAEWYAARGLDPNSVSLEQKQAAKV
LSRAKKTSVDREALRAEWQATAKELGIDFS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4pcb A high security double lock and key mechanism in HUH relaxases controls oriT-processing for plasmid conjugation.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		M1 L2 S3 H4 S72 A73 T74 R75 Q76 D77 S78 K79 R81 S89 A90 P91 K92 R128 K130 G133 R154 R178 A179 D183 V186 T189 R190 G193 D216 N218 R235 T236 K258 K262
Binding residue
(residue number reindexed from 1)		M1 L2 S3 H4 S59 A60 T61 R62 Q63 D64 S65 K66 R68 S76 A77 P78 K79 R115 K117 G120 R141 R165 A166 D170 V173 T176 R177 G180 D203 N205 R222 T223 K245 K249
Enzymatic activity
Enzyme Commision number ?
External links