Structure of PDB 4p0a Chain C Binding Site BS01

Receptor Information
>4p0a Chain C (length=168) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GEEEERAFLVAREELASALRRDSGQAFSLEQLRPLLASSLPLAARYLQLD
AARLVRCNAPRNYLNTLSTALNILEKYGRNLLSPQRPRYWRGVKFNNPVF
RSTVDAVQGGRDVLRLYGYTEEDGLSFPEGQEEPDEHQVATVTLEVLLLR
TELSLLLQNTHPRQQALE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4p0a Binding of OTULIN to the PUB domain of HOIP controls NF-kappa B signaling.
Resolution2.3001 Å
Binding residue
(original residue number in PDB)		Y82 N85 Y94 W95 N102 V104
Binding residue
(residue number reindexed from 1)		Y77 N80 Y89 W90 N97 V99
Enzymatic activity
Enzyme Commision number 2.3.2.31: RBR-type E3 ubiquitin transferase.
Gene Ontology
Molecular Function
GO:0004842 ubiquitin-protein transferase activity
Cellular Component
GO:0071797 LUBAC complex

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:4p0a, PDBe:4p0a, PDBj:4p0a
PDBsum4p0a
PubMed24726327
UniProtQ96EP0|RNF31_HUMAN E3 ubiquitin-protein ligase RNF31 (Gene Name=RNF31)

[Back to BioLiP]