Structure of PDB 4oxd Chain C Binding Site BS01

Receptor Information

>4oxd Chain C (length=167) Species: 171101 (Streptococcus pneumoniae R6) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

EVVNKGDYYSIQGKYDEIIVANKHYPLSKDYNPGENPTAKAELVKLIKAM
QEAGFPISDHYSGFRSYETQTKLYSARPGYSEHQTGLAFDVIGTDGDLVT
EEKAAQWLLDHAADYGFVVRYLKGKEKETGYMAEEWHLRYVGKEAKEIAE
SGLSLEEYYGFEGGDYV

Ligand information

>4oxd Chain H (length=5) Species: 1579 (Lactobacillus acidophilus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gAEKN

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4oxd Structure of the LdcB LD-carboxypeptidase reveals the molecular basis of peptidoglycan recognition.
Resolution	2.8 Å
Binding residue (original residue number in PDB)	D85 N87 P88
Binding residue (residue number reindexed from 1)	D30 N32 P33

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0008233	peptidase activity

	Biological Process
GO:0006508	proteolysis

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:4oxd, PDBe:4oxd, PDBj:4oxd
PDBsum	4oxd
PubMed	24909784
UniProt	Q8DQQ1

[Back to BioLiP]