Structure of PDB 4ogq Chain C Binding Site BS01

Receptor Information
>4ogq Chain C (length=281) Species: 103690 (Nostoc sp. PCC 7120 = FACHB-418) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YPFWAQQTYPETPREPTGRIVCANCHLAAKPTEVEVPQSVLPDTVFKAVV
KIPYDTSVQQVGADGSKVGLNVGAVLMLPEGFKIAPEDRIPEELKEEIGD
VYFQPYGEDKDNIVIVGPLPGEQYQEIVFPVLSPNPANDKNIHFGKYSVH
VGGNRGRGQVYPTGEKSNNNLYSAAATGTISKIAKQEGEDGSVKYLVDIS
DTIPAGPELIVSEGQAVTAGDALTNNPNVGGFGQLDAEIVLQDANRVGWL
IAFVALVMLAQVMLVLKKKQVEKVQAAEMNF
Ligand information
>4ogq Chain H (length=29) Species: 103690 (Nostoc sp. PCC 7120 = FACHB-418) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
MAILTLGWVSLLVVFTWSIAMVVWGRNGL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4ogq Internal Lipid Architecture of the Hetero-Oligomeric Cytochrome b6f Complex.
Resolution2.501 Å
Binding residue
(original residue number in PDB)		Q38 S39 V255 M266 Q269 V270 V273 K276 K277
Binding residue
(residue number reindexed from 1)		Q38 S39 V247 M258 Q261 V262 V265 K268 K269
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005506 iron ion binding
GO:0009055 electron transfer activity
GO:0020037 heme binding
Biological Process
GO:0015979 photosynthesis
Cellular Component
GO:0042651 thylakoid membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4ogq, PDBe:4ogq, PDBj:4ogq
PDBsum4ogq
PubMed24931468
UniProtQ93SW9|CYF_NOSS1 Cytochrome f (Gene Name=petA)

[Back to BioLiP]