Structure of PDB 4od7 Chain C Binding Site BS01

Receptor Information
>4od7 Chain C (length=187) Species: 529507 (Proteus mirabilis HI4320) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ADISEGKQYTNLSKPVAGAPQVVEFFSFYSPHCYQFSEVYKVNSTVEKNV
PENTKMARYHVDFLGPLGKEMTRAWAVAIALGVEDQVSPALFKGIQETQS
IRSVDDIRTTFINAGVKAEDYDAAINSFVVNSLVSQQQNAVTDFQINGVP
AMVIDGKYKMKNDGISAKSPEEYAKAYSDVVNQLLMK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4od7 Crystal Structure of the Dithiol Oxidase DsbA Enzyme from Proteus Mirabilis Bound Non-covalently to an Active Site Peptide Ligand.
Resolution1.597 Å
Binding residue
(original residue number in PDB)		S30 P31 H32 Y40 N147 G148 V149 P170 Y173
Binding residue
(residue number reindexed from 1)		S30 P31 H32 Y40 N147 G148 V149 P170 Y173
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0015036 disulfide oxidoreductase activity
GO:0016491 oxidoreductase activity
Cellular Component
GO:0042597 periplasmic space

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:4od7, PDBe:4od7, PDBj:4od7
PDBsum4od7
PubMed24831013
UniProtB4EZ68

[Back to BioLiP]