Structure of PDB 4ni9 Chain C Binding Site BS01

Receptor Information
>4ni9 Chain C (length=148) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RQPLTSSERIDKQIRYILDGISALRKETNNLNLPKMAEKDGCFQSGFNEE
TCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAI
TTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4ni9 Crystal structure of interleukin-6 in complex with a modified nucleic Acid ligand.
Resolution2.55 Å
Binding residue
(original residue number in PDB)
S107 S108 E110 Q111
Binding residue
(residue number reindexed from 1)
S76 S77 E79 Q80
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005125 cytokine activity
GO:0005138 interleukin-6 receptor binding
Biological Process
GO:0006955 immune response
GO:0030154 cell differentiation
Cellular Component
GO:0005576 extracellular region
GO:0005615 extracellular space

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4ni9, PDBe:4ni9, PDBj:4ni9
PDBsum4ni9
PubMed24415767
UniProtP05231|IL6_HUMAN Interleukin-6 (Gene Name=IL6)

[Back to BioLiP]