Structure of PDB 4ni9 Chain C Binding Site BS01

Receptor Information

>4ni9 Chain C (length=148) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

RQPLTSSERIDKQIRYILDGISALRKETNNLNLPKMAEKDGCFQSGFNEE
TCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAI
TTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM

Ligand information

>4ni9 Chain B (length=32) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ggcagguuugguauuaacacguuaagucgugg

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4ni9 Crystal structure of interleukin-6 in complex with a modified nucleic Acid ligand.
Resolution	2.55 Å
Binding residue (original residue number in PDB)	S107 S108 E110 Q111
Binding residue (residue number reindexed from 1)	S76 S77 E79 Q80

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005125	cytokine activity
GO:0005138	interleukin-6 receptor binding

	Biological Process
GO:0006955	immune response
GO:0030154	cell differentiation

	Cellular Component
GO:0005576	extracellular region
GO:0005615	extracellular space

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4ni9, PDBe:4ni9, PDBj:4ni9
PDBsum	4ni9
PubMed	24415767
UniProt	P05231\|IL6_HUMAN Interleukin-6 (Gene Name=IL6)

[Back to BioLiP]