Structure of PDB 4mli Chain C Binding Site BS01

Receptor Information
>4mli Chain C (length=83) Species: 1314 (Streptococcus pyogenes) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DSATHIKFSKRDEDGKELAGATMELRDSSGKTISTWISDGQVKDFYLYPG
KYTFVETAAPDGYEVATAITFTVNEQGQVTVNG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4mli Structural Analysis and Optimization of the Covalent Association between SpyCatcher and a Peptide Tag.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		K28 F29 S30 K31 R32 E34 M44 F75 E77 G83 Y84 E85 A87 I90 F92
Binding residue
(residue number reindexed from 1)		K7 F8 S9 K10 R11 E13 M23 F54 E56 G62 Y63 E64 A66 I69 F71
Enzymatic activity
Enzyme Commision number ?
External links