Structure of PDB 4mbe Chain C Binding Site BS01

Receptor Information
>4mbe Chain C (length=94) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TMDTAQLKSQIQQYLVESGNYELISNELKARLLQEGWVDKVKDLTKSEMN
INESTNFTQILSTVEPKALEMVSDSTRETVLKQIREFLEEIVDT
Ligand information
>4mbe Chain G (length=9) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
LPTVGFDFI
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4mbe Structural basis for binding the TREX2 complex to nuclear pores, GAL1 localisation and mRNA export.
Resolution2.612 Å
Binding residue
(original residue number in PDB)		K9 Q13 V17 Y22
Binding residue
(residue number reindexed from 1)		K8 Q12 V16 Y21
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003682 chromatin binding
GO:0003713 transcription coactivator activity
GO:0005515 protein binding
GO:0008047 enzyme activator activity
Biological Process
GO:0000973 post-transcriptional tethering of RNA polymerase II gene DNA at nuclear periphery
GO:0006325 chromatin organization
GO:0006357 regulation of transcription by RNA polymerase II
GO:0006368 transcription elongation by RNA polymerase II
GO:0006406 mRNA export from nucleus
GO:0015031 protein transport
GO:0016973 poly(A)+ mRNA export from nucleus
GO:0032880 regulation of protein localization
GO:0045893 positive regulation of DNA-templated transcription
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0051028 mRNA transport
GO:0071028 nuclear mRNA surveillance
Cellular Component
GO:0000124 SAGA complex
GO:0000932 P-body
GO:0005634 nucleus
GO:0005643 nuclear pore
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0046695 SLIK (SAGA-like) complex
GO:0070390 transcription export complex 2
GO:0071819 DUBm complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4mbe, PDBe:4mbe, PDBj:4mbe
PDBsum4mbe
PubMed24705649
UniProtQ6WNK7|SUS1_YEAST Transcription and mRNA export factor SUS1 (Gene Name=SUS1)

[Back to BioLiP]