Structure of PDB 4m9v Chain C Binding Site BS01

Receptor Information
>4m9v Chain C (length=60) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PSERPFFCNFCGKTYRDASGLSRHRRAHLGYRPRSCPECGKCFRDQSQVN
RHLKVHQNKP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4m9v DNA recognition of 5-carboxylcytosine by a zfp57 mutant at an atomic resolution of 0.97 angstrom.
Resolution0.969 Å
Binding residue
(original residue number in PDB)		S156 R157 R159 R160 D179 Q180 S181 Q182
Binding residue
(residue number reindexed from 1)		S22 R23 R25 R26 D45 Q46 S47 Q48
Binding affinityPDBbind-CN: Kd=7nM
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4m9v, PDBe:4m9v, PDBj:4m9v
PDBsum4m9v
PubMed24236546
UniProtQ8C6P8|ZFP57_MOUSE Zinc finger protein 57 (Gene Name=Zfp57)

[Back to BioLiP]