Structure of PDB 4m5t Chain C Binding Site BS01

Receptor Information
>4m5t Chain C (length=85) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQEHGFISRC
FHRKYRIPADVDPLTITSSLSSDGVLTVNGPRKQV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4m5t The structured core domain of alpha B-crystallin can prevent amyloid fibrillation and associated toxicity.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		P86 V91 K92 V93 P130 I133 T134 S135 S136 L137
Binding residue
(residue number reindexed from 1)		P20 V25 K26 V27 P63 I66 T67 S68 S69 L70
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4m5t, PDBe:4m5t, PDBj:4m5t
PDBsum4m5t
PubMed24711386
UniProtP02511|CRYAB_HUMAN Alpha-crystallin B chain (Gene Name=CRYAB)

[Back to BioLiP]