Structure of PDB 4lfl Chain C Binding Site BS01

Receptor Information
>4lfl Chain C (length=142) Species: 568704 (Lacticaseibacillus rhamnosus Lc 705) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MDVIIGADKDGFAMKEQVKKYLEEHQYRVADVTPEPAEDFVESSLAVTKK
LLNSDAHKAIMFDRYGVGSAMASNKVKGMVTAVVEEENTAHMTAEHNGAK
AIAIGTGITGYDRALVIIQRYLDTEYAGGRHQIRLDMLEKMI
Ligand information
Ligand IDTG6
InChIInChI=1S/C6H13O9P/c7-1-3(8)5(10)6(11)4(9)2-15-16(12,13)14/h4-7,9-11H,1-2H2,(H2,12,13,14)/t4-,5-,6+/m1/s1
InChIKeyGSXOAOHZAIYLCY-PBXRRBTRSA-N
SMILES
SoftwareSMILES
CACTVS 3.385OCC(=O)[CH](O)[CH](O)[CH](O)CO[P](O)(O)=O
ACDLabs 12.01O=P(OCC(O)C(O)C(O)C(=O)CO)(O)O
CACTVS 3.385OCC(=O)[C@@H](O)[C@@H](O)[C@H](O)CO[P](O)(O)=O
OpenEye OEToolkits 1.7.6C(C(C(C(C(=O)CO)O)O)O)OP(=O)(O)O
OpenEye OEToolkits 1.7.6C([C@H]([C@@H]([C@@H](C(=O)CO)O)O)O)OP(=O)(O)O
FormulaC6 H13 O9 P
Name6-O-phosphono-D-tagatose
ChEMBL
DrugBankDB04277
ZINCZINC000085550138
PDB chain4lfl Chain D Residue 201 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4lfl Crystal structure and substrate specificity of D-galactose-6-phosphate isomerase complexed with substrates.
Resolution1.65 Å
Binding residue
(original residue number in PDB)		H96 N97 R130 R134
Binding residue
(residue number reindexed from 1)		H96 N97 R130 R134
Annotation score1
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Fri May 2 18:55:12 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '4lfl', asym_id = 'C', bs = 'BS01', title = 'Crystal structure and substrate specificity of D...-6-phosphate isomerase complexed with substrates.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='4lfl', asym_id='C', bs='BS01', title='Crystal structure and substrate specificity of D...-6-phosphate isomerase complexed with substrates.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0005975,0016853', uniprot = '', pdbid = '4lfl', asym_id = 'C'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0005975,0016853', uniprot='', pdbid='4lfl', asym_id='C')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>