Structure of PDB 4l8r Chain C Binding Site BS01

Receptor Information
>4l8r Chain C (length=67) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DFETDESVLMRRQKQINYGKNTIAYDRYIKEVPGIHPKTPNKFKKYSRRS
WDQQIKLWKVALHFWDP
Ligand information
>4l8r Chain A (length=26) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ccaaaggcucuuuucagagccaccca
.....<<<<<<....>>>>>>.....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4l8r Structure of Histone Mrna Stem-Loop, Human Stem-Loop Binding Protein, and 3'Hexo Ternary Complex.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		Y144 Y178 S179 R180 R181 S182 Q185 K188 K191 H195
Binding residue
(residue number reindexed from 1)		Y18 Y46 S47 R48 R49 S50 Q53 K56 K59 H63
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003729 mRNA binding

View graph for
Molecular Function
External links
PDB RCSB:4l8r, PDBe:4l8r, PDBj:4l8r
PDBsum4l8r
PubMed23329046
UniProtQ14493|SLBP_HUMAN Histone RNA hairpin-binding protein (Gene Name=SLBP)

[Back to BioLiP]