Structure of PDB 4l5r Chain C Binding Site BS01

Receptor Information
>4l5r Chain C (length=198) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TPKKNISKGAVLHEKPMTVMVLTATEPFNYKEGKENMFHATVATESKYYR
VKVFNMDLKEKFTENQFITISKYFNSSGILEINETATVSEAAPNQMFEVP
KNIIRSAKETLKISKIKELDSGTLIYGVFAVEKKKVNDKSITFKIKDNED
NIKVVWDKEQHNINYEKGDKLQLFSFHLRKGNGKPILHSGNHSFIKGE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4l5r Molecular Mechanism for p202-Mediated Specific Inhibition of AIM2 Inflammasome Activation.
Resolution1.873 Å
Binding residue
(original residue number in PDB)		S166 G167 H222 R224 G226 N227 G235 N236
Binding residue
(residue number reindexed from 1)		S121 G122 H177 R179 G181 N182 G190 N191
Binding affinityPDBbind-CN: Kd=1.7uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0002218 activation of innate immune response
GO:0035458 cellular response to interferon-beta

View graph for
Biological Process
External links
PDB RCSB:4l5r, PDBe:4l5r, PDBj:4l5r
PDBsum4l5r
PubMed23850291
UniProtQ9R002|IFI2_MOUSE Interferon-activable protein 202 (Gene Name=Ifi202)

[Back to BioLiP]