Structure of PDB 4ktc Chain C Binding Site BS01

Receptor Information

>4ktc Chain C (length=179) Species: 11116 (Hepatitis C virus (isolate Japanese))

APITAYSQQTRGLLGCIITSLTGRDKNQVDGEVQVLSTATQSFLATCVNG
VCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWPAPPGARSMTPCTCG
SSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHV
VGIFRAAVCTRGVAKAVDFIPVESMETTM

Ligand information

>4ktc Chain D (length=13) Species: 32630 (synthetic construct)

KGSVVIVGRIILS

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4ktc Discovery of Danoprevir (ITMN-191/R7227), a Highly Selective and Potent Inhibitor of Hepatitis C Virus (HCV) NS3/4A Protease.
• Resolution: 2.3 Å
• Binding residue (original residue number in PDB): T4 A5 Y6 S7 Q8 T10 R11 C16 S20 Q28 D30 E32 V33 Q34 V35 L36 S37 K62 T63 L64 A65 M94
• Binding residue (residue number reindexed from 1): T4 A5 Y6 S7 Q8 T10 R11 C16 S20 Q28 D30 E32 V33 Q34 V35 L36 S37 K62 T63 L64 A65 M94

Enzymatic activity

• Catalytic site (original residue number in PDB): H57 D81 G137 S139
• Catalytic site (residue number reindexed from 1): H57 D81 G137 S139
• Enzyme Commision number: 2.7.7.48: RNA-directed RNA polymerase.
  3.4.21.98: hepacivirin.
  3.4.22.-
  3.6.1.15: nucleoside-triphosphate phosphatase.
  3.6.4.13: RNA helicase.

Gene Ontology

Molecular Function

• GO:0008236 serine-type peptidase activity

Biological Process

• GO:0006508 proteolysis
• GO:0019087 transformation of host cell by virus

External links

• PDB: RCSB:4ktc, PDBe:4ktc, PDBj:4ktc
• PDBsum: 4ktc
• PubMed: 23672640
• UniProt: P26662|POLG_HCVJA Genome polyprotein