Structure of PDB 4knl Chain C Binding Site BS01

Receptor Information

>4knl Chain C (length=207) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SLPKYKPQVNSSINDYICKNNLKAPKIEEDYTSYFPKYAYRNGVGRPEGI
VVHDTANDRSTINGEISYMKNNYQNAFVHAFVDGDRIIETAPTDYLSWGV
GAVGNPRFINVEIVHTHDYASFARSMNNYADYAATQLQYYGLKPDSAEYD
GNGTVWTHYAVSKYLGGTDHADPHGYLRSHNYSYDQLYDLINEKYLIKMG
KVAPWGT

Ligand information

>4knl Chain F (length=4) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

AEKA

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4knl Structure-function analysis of Staphylococcus aureus amidase reveals the determinants of peptidoglycan recognition and cleavage.
Resolution	1.55 Å
Binding residue (original residue number in PDB)	N287 A288 W310 G311 G313 H370 T380 H382
Binding residue (residue number reindexed from 1)	N75 A76 W98 G99 G101 H158 T168 H170

Enzymatic activity

Enzyme Commision number

3.2.1.96: mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase.
3.5.1.28: N-acetylmuramoyl-L-alanine amidase.

Gene Ontology

	Molecular Function
GO:0008745	N-acetylmuramoyl-L-alanine amidase activity

	Biological Process
GO:0009253	peptidoglycan catabolic process

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:4knl, PDBe:4knl, PDBj:4knl
PDBsum	4knl
PubMed	24599952
UniProt	Q2FZK7\|ATL_STAA8 Bifunctional autolysin (Gene Name=atl)

[Back to BioLiP]