Structure of PDB 4kdp Chain C Binding Site BS01

Receptor Information

>4kdp Chain C (length=151) Species: 176280 (Staphylococcus epidermidis ATCC 12228) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MVRRIEDHISFLEKFINDVNTLTAKLLKDLQTEYGISAEQSHVLNMLSIE
ALTVGQITEKQGVNKAAVSRRVKKLLNAELVKLEKPDSNTDQRLKIIKLS
NKGKKYIKERKAIMSHIASDMTSDFDSKEIEKVRQVLEIIDYRIQSYTSK
L

Ligand information

>4kdp Chain J (length=10) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

cgcgcagccc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4kdp TcaR-ssDNA complex crystal structure reveals new DNA binding mechanism of the MarR family proteins.
Resolution	3.6 Å
Binding residue (original residue number in PDB)	K65 A66
Binding residue (residue number reindexed from 1)	K65 A66

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:4kdp, PDBe:4kdp, PDBj:4kdp
PDBsum	4kdp
PubMed	24531929
UniProt	A0A0H2VJZ8

[Back to BioLiP]