Structure of PDB 4jng Chain C Binding Site BS01

Receptor Information
>4jng Chain C (length=224) Species: 1133363 (Schmallenberg virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FIFEDVPQRNAATFNPEVGYVAFIGKYGQQLNFGVARVFFLNQKKAKMVL
HKTAQPSVDLTFGGVKFTVVNNHFPQYVSNPVPDNAITLHRMSGYLARWI
ADTCKASVLKLAEASAQIVMPLAEVKGCTWADGYTMYLGFAPGAEMFLDA
FDFYPLVIEMHRVLKDNMDVNFMKKVLRQRYGTMTAEEWMTQKITEIKAA
FNSVGQLAWAKGFSPAARTFLQQF
Ligand information
>4jng Chain L (length=42) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
uuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuu
..........................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4jng Crystal structure of Schmallenberg orthobunyavirus nucleoprotein-RNA complex reveals a novel RNA sequestration mechanism.
Resolution2.12 Å
Binding residue
(original residue number in PDB)		A15 K48 N76 H77 V82 V86 T92 R95 V123 P125 L126 E128 V129 R166 M172 F176 K179
Binding residue
(residue number reindexed from 1)		A11 K44 N72 H73 V78 V82 T88 R91 V119 P121 L122 E124 V125 R162 M168 F172 K175
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0019013 viral nucleocapsid
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:4jng, PDBe:4jng, PDBj:4jng
PDBsum4jng
PubMed23798666
UniProtH2AM13|NCAP_SBVBH Nucleoprotein (Gene Name=N)

[Back to BioLiP]