Structure of PDB 4j9h Chain C Binding Site BS01

Receptor Information

>4j9h Chain C (length=56) Species: 9606 (Homo sapiens)

NLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPS
NYITPV

Ligand information

>4j9h Chain L (length=10)

APTYPPPPPP

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4j9h Crystallization by capillary counter-diffusion and structure determination of the N114A mutant of the SH3 domain of Abl tyrosine kinase complexed with a high-affinity peptide ligand.
• Resolution: 1.7 Å
• Binding residue (original residue number in PDB): Y70 S75 N78 E98 W99 W110 N114 Y115
• Binding residue (residue number reindexed from 1): Y7 S12 N15 E35 W36 W47 N51 Y52

Enzymatic activity

• Enzyme Commision number: 2.7.10.2: non-specific protein-tyrosine kinase.

External links

• PDB: RCSB:4j9h, PDBe:4j9h, PDBj:4j9h
• PDBsum: 4j9h
• UniProt: P00519|ABL1_HUMAN Tyrosine-protein kinase ABL1 (Gene Name=ABL1)