Structure of PDB 4irv Chain C Binding Site BS01

Receptor Information
>4irv Chain C (length=192) Species: 85962 (Helicobacter pylori 26695) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QQFINNLQVAFIKVDNVVASFDPDQKPIVDKNDRDNRQAFDGISQLREEY
SNKAIKNPTKKNQYFSDFIDKSNDLINKDNLIDVESSTKSFQKFGDQRYQ
IFTSWVSHQKDPSKINTRSIRNFMENIIQPPIPDDKEKAEFLKSAKQSFA
GIIIGNQIRTDQKFMGVFDESLKERQEAPTGGDWLDIFLSFI
Ligand information
>4irv Chain G (length=20) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GPNIQKLLYQRTTIAAMETI
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4irv Structure of the Helicobacter pylori CagA oncoprotein bound to the human tumor suppressor ASPP2.
Resolution2.04 Å
Binding residue
(original residue number in PDB)		F26 I105 V107 E108 T111 F114 D119 Q123 T126 Q170 S171 G174 I175 P207 G209 G210 S218 F219 I220
Binding residue
(residue number reindexed from 1)		F3 I82 V84 E85 T88 F91 D96 Q100 T103 Q147 S148 G151 I152 P179 G181 G182 S190 F191 I192
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0019534 toxin transmembrane transporter activity

View graph for
Molecular Function
External links
PDB RCSB:4irv, PDBe:4irv, PDBj:4irv
PDBsum4irv
PubMed24474782
UniProtP55980|CAGA_HELPY Cytotoxicity-associated immunodominant antigen (Gene Name=cagA)

[Back to BioLiP]