Structure of PDB 4iox Chain C Binding Site BS01

Receptor Information

>4iox Chain C (length=220) Species: 10298 (Human alphaherpesvirus 1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PVLTKSAGERFLLYRPSTTTNSGLMAPDLYVYVDPAGTGVAVVGRYRDDY
IIFALEHFFLGSAPADIARCVVHSLTQVLALHPGAFRGVRVAVEGNSSQD
SAVAIATHVHTEMHRLLGPELLFYHCEPPGSAVLYPFFLLNKQKTPAFEH
FIKKFNSGGVMASQEIVSATVRLQTDPVEYLLEQLNNLTETVSDDLMVAV
IMAIYLAAQAGPPHTFAPIT

Ligand information

>4iox Chain D (length=6) Species: 10298 (Human alphaherpesvirus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

AAAAAA

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4iox The Structure of the Herpes Simplex Virus DNA-Packaging Terminase pUL15 Nuclease Domain Suggests an Evolutionary Lineage among Eukaryotic and Prokaryotic Viruses.
Resolution	2.458 Å
Binding residue (original residue number in PDB)	N683 L684 T685 E686 T687
Binding residue (residue number reindexed from 1)	N187 L188 T189 E190 T191

Enzymatic activity

Catalytic site (original residue number in PDB)	L499
Catalytic site (residue number reindexed from 1)	L24
Enzyme Commision number	3.1.-.-

Gene Ontology

	Biological Process
GO:0051276	chromosome organization

View graph for
Biological Process

External links

PDB	RCSB:4iox, PDBe:4iox, PDBj:4iox
PDBsum	4iox
PubMed	23596306
UniProt	P04295\|TRM3_HHV11 Tripartite terminase subunit 3 (Gene Name=TRM3)

[Back to BioLiP]