Structure of PDB 4ijs Chain C Binding Site BS01

Receptor Information

>4ijs Chain C (length=232) Species: 35304 (Bunyamwera virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

IELEFHDVAANTSSTFDPEVAYANFKRVHTTGLSYDHIRIFYIKGREIKT
SLAKRSEWEVTLNLGGWKITVYNTNFPGNRNSPVPDDGLTLHRLSGFLAR
YLLEKMLKVSEPEKLIIKSKIINPLAEKNGITWNDGEEVYLSFFPGSEMF
LGTFRFYPLAIGIYKVQRKEMEPKYLEKTMRQRYMGLEAATWTVSKLTEV
QSALTVVSSLGWKKTNVSAAARDFLAKFGINM

Ligand information

>4ijs Chain G (length=9) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aaaaaaaaa

.........

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4ijs Bunyamwera virus possesses a distinct nucleocapsid protein to facilitate genome encapsidation
Resolution	3.2 Å
Binding residue (original residue number in PDB)	T13 S15 T16 F17 D18 R47 T75 N76 R81 R94 P125 L126 E128 K129 Y176 R182 R184
Binding residue (residue number reindexed from 1)	T12 S14 T15 F16 D17 R46 T74 N75 R80 R93 P124 L125 E127 K128 Y175 R181 R183

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003723	RNA binding

	Biological Process
GO:0039657	symbiont-mediated suppression of host gene expression

	Cellular Component
GO:0019013	viral nucleocapsid
GO:0019029	helical viral capsid
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4ijs, PDBe:4ijs, PDBj:4ijs
PDBsum	4ijs
PubMed	23569257
UniProt	P16495\|NCAP_BUNYW Nucleoprotein (Gene Name=N)

[Back to BioLiP]