Structure of PDB 4i7d Chain C Binding Site BS01

Receptor Information
>4i7d Chain C (length=189) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NSVLFPCKYASSGCEITLPHTEKADHEELCEFRPYSCPCPGASCKWQGSL
DAVMPHLMHQHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGFHFML
VLEKQEKGHQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTWEATPRSI
HEGIATAIMNSDCLVFDTSIAQLFAENGNLGINVTISMC
Ligand information
>4i7d Chain D (length=13) Species: 7227 (Drosophila melanogaster) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KLRPVAMVRPKVR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4i7d Structure-based design of covalent siah inhibitors.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		C130 L158 D162 I163 V164 F165 L166 T168 V176 D177 W178 M180 E194
Binding residue
(residue number reindexed from 1)		C39 L67 D71 I72 V73 F74 L75 T77 V85 D86 W87 M89 E103
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
Gene Ontology
Molecular Function
GO:0008270 zinc ion binding
Biological Process
GO:0006511 ubiquitin-dependent protein catabolic process
GO:0007275 multicellular organism development
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4i7d, PDBe:4i7d, PDBj:4i7d
PDBsum4i7d
PubMed23891150
UniProtQ8IUQ4|SIAH1_HUMAN E3 ubiquitin-protein ligase SIAH1 (Gene Name=SIAH1)

[Back to BioLiP]