Structure of PDB 4i7b Chain C Binding Site BS01

Receptor Information
>4i7b Chain C (length=187) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VLFPCKYASSGCEITLPHTEKADHEELCEFRPYSCPCPGASCKWQGSLDA
VMPHLMHQHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGFHFMLVL
EKQEDGHQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTWEATPRSIHE
GIATAIMNSDCLVFDTSIAQLFAENGNLGINVTISMC
Ligand information
>4i7b Chain D (length=11) Species: 7227 (Drosophila melanogaster) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
LRPVAMVRPTV
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4i7b Structure-based design of covalent siah inhibitors.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		T156 L158 D162 I163 V164 F165 L166 T168 V176 D177 W178 V179 M180 N276
Binding residue
(residue number reindexed from 1)		T63 L65 D69 I70 V71 F72 L73 T75 V83 D84 W85 V86 M87 N181
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
Gene Ontology
Molecular Function
GO:0008270 zinc ion binding
Biological Process
GO:0006511 ubiquitin-dependent protein catabolic process
GO:0007275 multicellular organism development
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4i7b, PDBe:4i7b, PDBj:4i7b
PDBsum4i7b
PubMed23891150
UniProtQ8IUQ4|SIAH1_HUMAN E3 ubiquitin-protein ligase SIAH1 (Gene Name=SIAH1)

[Back to BioLiP]