Structure of PDB 4hp1 Chain C Binding Site BS01

Receptor Information
>4hp1 Chain C (length=51) Species: 8364 (Xenopus tropicalis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NKKRKRCGVCVPCLRKEPCGACYNCVNRSTSHQICKMRKCEQLKKKRVVP
M
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4hp1 Tet3 CXXC Domain and Dioxygenase Activity Cooperatively Regulate Key Genes for Xenopus Eye and Neural Development.
Resolution2.25 Å
Binding residue
(original residue number in PDB)		K61 R62 H90 Q91 R96 K97 R105 P108 M109
Binding residue
(residue number reindexed from 1)		K3 R4 H32 Q33 R38 K39 R47 P50 M51
Binding affinityPDBbind-CN: Kd=7uM
Enzymatic activity
Enzyme Commision number 1.14.11.80: methylcytosine dioxygenase.
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0008270 zinc ion binding

View graph for
Molecular Function
External links
PDB RCSB:4hp1, PDBe:4hp1, PDBj:4hp1
PDBsum4hp1
PubMed23217707
UniProtA0JP82|TET3_XENTR Methylcytosine dioxygenase tet3 (Gene Name=tet3)

[Back to BioLiP]