Structure of PDB 4hjb Chain C Binding Site BS01

Receptor Information

>4hjb Chain C (length=30) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

RMKQIEDKLEEILSKLYHIEMELFIKMLLG

Ligand information

>4hjb Chain A (length=29) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

RMKQIEDKLEEILSKLYHIEMELFIKMLL

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4hjb Differential Impact of beta and gamma Residue Preorganization on alpha / beta / gamma-Peptide Helix Stability in Water.
Resolution	1.25 Å
Binding residue (original residue number in PDB)	R1 I5 K8 E11 I12 K15 H18 I19 E22 I25
Binding residue (residue number reindexed from 1)	R1 I5 K8 E11 I12 K15 H18 I19 E22 I25

External links

PDB	RCSB:4hjb, PDBe:4hjb, PDBj:4hjb
PDBsum	4hjb
PubMed	23701135

[Back to BioLiP]