Structure of PDB 4h44 Chain C Binding Site BS01

Receptor Information

>4h44 Chain C (length=289) Species: 103690 (Nostoc sp. PCC 7120 = FACHB-418) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

YPFWAQQTYPETPREPTGRIVCANCHLAAKPTEVEVPQSVLPDTVFKAVV
KIPYDTSVQQVGADGSKVGLNVGAVLMLPEGFKIAPEDRIPEELKEEIGD
VYFQPYGEDKDNIVIVGPLPGEQYQEIVFPVLSPNPANDKNIHFGKYSVH
VGGNRGRGQVYPTGEKSNNNLYSAAATGTISKIAKQEGEDGSVKYLVDIK
TESGEVVSDTIPAGPELIVSEGQAVTAGDALTNNPNVGGFGQLDAEIVLQ
DANRVGWLIAFVALVMLAQVMLVLKKKQVEKVQAAEMNF

Ligand information

>4h44 Chain H (length=29) Species: 103690 (Nostoc sp. PCC 7120 = FACHB-418) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

MAILTLGWVSLLVVFTWSIAMVVWGRNGL

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4h44 Quinone-dependent proton transfer pathways in the photosynthetic cytochrome b6f complex
Resolution	2.7 Å
Binding residue (original residue number in PDB)	Q38 S39 V40 L41 V255 I259 V262 M266 Q269 V270 V273 K276 K277
Binding residue (residue number reindexed from 1)	Q38 S39 V40 L41 V255 I259 V262 M266 Q269 V270 V273 K276 K277

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005506	iron ion binding
GO:0009055	electron transfer activity
GO:0020037	heme binding
GO:0046872	metal ion binding

	Biological Process
GO:0015979	photosynthesis

	Cellular Component
GO:0009579	thylakoid
GO:0016020	membrane
GO:0031676	plasma membrane-derived thylakoid membrane
GO:0042651	thylakoid membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4h44, PDBe:4h44, PDBj:4h44
PDBsum	4h44
PubMed	23440205
UniProt	Q93SW9\|CYF_NOSS1 Cytochrome f (Gene Name=petA)

[Back to BioLiP]