Structure of PDB 4gzn Chain C Binding Site BS01

Receptor Information
>4gzn Chain C (length=59) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SERPFFCNFCGKTYRDASGLSRHRRAHLGYRPRSCPECGKCFRDQSEVNR
HLKVHQNKP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4gzn An atomic model of Zfp57 recognition of CpG methylation within a specific DNA sequence.
Resolution0.99 Å
Binding residue
(original residue number in PDB)		S156 R157 R159 R160 D179 Q180 S181
Binding residue
(residue number reindexed from 1)		S21 R22 R24 R25 D44 Q45 S46
Binding affinityPDBbind-CN: Kd=8nM
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4gzn, PDBe:4gzn, PDBj:4gzn
PDBsum4gzn
PubMed23059534
UniProtQ8C6P8|ZFP57_MOUSE Zinc finger protein 57 (Gene Name=Zfp57)

[Back to BioLiP]