Structure of PDB 4gnx Chain C Binding Site BS01

Receptor Information
>4gnx Chain C (length=433) Species: 237631 () [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IYPIEGLSPYQNRWTIKARVTSKSDIRHWSNQRGEGKLFSVNLLDDSGEI
KATGFNDAVDRFYPLLQENHVYLISKARVNIAKKQFSNLQNEYEITFENS
TEIEECTDATDVPEVKYEFVRINELESVEANQQCDVIGILDSYGELSEIV
SKASQRPVQKRELTLVDQGNRSVKLTLWGKTAETFPTNAGVDEKPVLAFK
GVKVGDFGGRSLSMFSSSTMLINPDITESHVLRGWYDNDGAHAQFQPYTN
GGGAGANMAERRTIVQVKDENLGMSEKPDYFNVRATVVYIKQENLYYTAC
ASEGCNKKVNLDHENNWRCEKCDRSYATPEYRYILSTNVADATGQMWLSG
FNEDATQLIGMSAGELHKLREESESEFSAALHRAANRMYMFNCRAKMDTF
NDTARVRYTISRAAPVDFAKAGMELVDAIRAYM
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4gnx Structure of
Resolution2.8 Å
Binding residue
(original residue number in PDB)
R208 W210 R214 F236 F267 S332 V339 K341 W359 K384 F388 S394 S397 G442 G443 A444 G445 A446 M448 Y470 Y479 K481 Y487 N496 K497 K498 S526 W537 F541 F590 R595 R597
Binding residue
(residue number reindexed from 1)
R27 W29 R33 F55 F86 S151 V158 K160 W178 K203 F207 S213 S216 G252 G253 A254 G255 A256 M258 Y280 Y289 K291 Y297 N306 K307 K308 S336 W347 F351 F400 R405 R407
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Sun Nov 17 12:57:23 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '4gnx', asym_id = 'C', bs = 'BS01', title = 'Structure of'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='4gnx', asym_id='C', bs='BS01', title='Structure of')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0003676,0003677,0005634,0006260,0006281,0006310', uniprot = '', pdbid = '4gnx', asym_id = 'C'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003676,0003677,0005634,0006260,0006281,0006310', uniprot='', pdbid='4gnx', asym_id='C')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>