Structure of PDB 4gcl Chain C Binding Site BS01

Receptor Information
>4gcl Chain C (length=190) Species: 364106 (Escherichia coli UTI89) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RNRREEILQSLALMLESSDGSQRITTAKLAASVGVSEAALYRHFPSKTRM
FDSLIEFIEDSLITRINLILKDEKDTTARLRLIVLLLLGFGERNPGLTRI
LTGHALMFEQDRLQGRINQLFERIEAQLRQVLREKRMREGEGYATDETLL
ASQILAFCEGMLSRFVRSEFKYRPTDDFDARWPLIAAQLQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4gcl SlmA forms a higher-order structure on DNA that inhibits cytokinetic Z-ring formation over the nucleoid.
Resolution2.65 Å
Binding residue
(original residue number in PDB)		R31 T33 T34 A46 Y49 S54 K55
Binding residue
(residue number reindexed from 1)		R23 T25 T26 A38 Y41 S46 K47
Binding affinityPDBbind-CN: Kd=156.5nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0010974 negative regulation of division septum assembly
GO:0051301 cell division
GO:0051302 regulation of cell division
Cellular Component
GO:0005737 cytoplasm
GO:0009295 nucleoid
GO:0043590 bacterial nucleoid

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4gcl, PDBe:4gcl, PDBj:4gcl
PDBsum4gcl
PubMed23754405
UniProtQ1R4V1

[Back to BioLiP]