Structure of PDB 4g91 Chain C Binding Site BS01

Receptor Information
>4g91 Chain C (length=117) Species: 227321 (Aspergillus nidulans FGSC A4) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GTWANVNQGLQGTARDILTTYWQHVINHLESDNHDYKIHQLPLARIKKVM
KADPEVKMISAEAPILFAKGCDVFITELTMRAWIHAEDNKRRTLQRSDIA
AALSKSDMFDFLIDIVP
Ligand information
>4g91 Chain A (length=28) Species: 162425 (Aspergillus nidulans) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ESPLYVNAKQFHRILKRRVARQKLEEQL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4g91 DNA Minor Groove Sensing and Widening by the CCAAT-Binding Complex.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		D153 M154 D156 F157 I159 D160
Binding residue
(residue number reindexed from 1)		D107 M108 D110 F111 I113 D114
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0046982 protein heterodimerization activity

View graph for
Molecular Function
External links
PDB RCSB:4g91, PDBe:4g91, PDBj:4g91
PDBsum4g91
PubMed22902862
UniProtC8V0B5

[Back to BioLiP]